PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G36800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 387aa    MW: 41129.6 Da    PI: 5.3343
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G36800.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.37.1e-13303346548
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      +r+rr++kNRe+A rsR+RK+a++ eLe +   L++eN  Lk+ 
  OPUNC01G36800.1 303 RRQRRMIKNRESAARSRARKQAYTVELEAELNYLKQENACLKEA 346
                      79************************************999854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-13299364IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.312301345IPR004827Basic-leucine zipper domain
PfamPF001705.0E-11303349IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.1E-12303346No hitNo description
SuperFamilySSF579592.38E-10303347No hitNo description
CDDcd147075.67E-22303344No hitNo description
PROSITE patternPS000360306321IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MASEMSKNVK VADDQEVTSQ ERDQSGGIKA GGEEEIAPLA RQSSILSLTL EELQNSLCEP  60
GRNFGSMNMD EFVANIWNAE EFQAATGGCK GAMEEAKVVD GGSGGGDAGG SGLCRQGSFS  120
LPLPLCQKTV EEVWAEINQA PAHTSAPASA LQPHAGSGGV AANDRQVTLG EMTLEDFLVK  180
AGVVRGSFTG QAAMGAGMVN GPVNPMQQGQ GGPMMFPVGP VNAMYPVMGD GMGYPAGYNG  240
MAIVPPPPPT QGAMAVVSPG SSDGMSAMTH ADMMNCIGNG MIENGTRKRP HREDGCAEKT  300
VERRQRRMIK NRESAARSRA RKQAYTVELE AELNYLKQEN ACLKEAEKTV LLTKKQMLVE  360
KMMEQSKEKM NASRGGNQLR RSGSCMW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1996310.0EF199631.1 Oryza sativa (japonica cultivar-group) bZIP-type transcription factor ABI5 isoform 2 (ABI5) mRNA, complete cds, alternatively spliced.
GenBankJQ0018180.0JQ001818.1 Oryza sativa Japonica Group ABRE-binding bZIP transcription factor (OREB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628684.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_015628691.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLA0A0E0JRB10.0A0A0E0JRB1_ORYPU; Uncharacterized protein
STRINGORGLA01G0317900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.25e-52abscisic acid responsive element-binding factor 1